View larger

Recombinant Uncharacterized membrane protein Mb2670 (Mb2670)

CSB-CF352528MVH

Recombinant Uncharacterized membrane protein Mb2670 (Mb2670)

See below for Detailed Description

More details

CAD$1,565.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mycobacterium bovis

Uniprot NO.:P63912

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDVEALLQSIPPLMVYLVVGAVVGIESLGIPLPGEIVLVSAAVLSSHPELAVNPIGVGGA AVIGAVVGDSIGYSIGRRFGLPLFDRLGRRFPKHFGPGHVALAERLFNRWGVRAVFLGRF IALLRIFAGPLAGALKMPYPRFLAANVTGGICWAGGTTALVYFAGMAAQHWLERFSWIAL VIAVIAGITAAILLRERTSRAIAELEAEHCRKAGTTAA

Protein Names:Recommended name: Uncharacterized membrane protein Mb2670

Gene Names:Ordered Locus Names:Mb2670

Expression Region:1-218

Sequence Info:full length protein

30 other products in the same category: