View larger

Recombinant Chicken Frizzled-8(FZD8)

CSB-CF878007CH

Recombinant Chicken Frizzled-8(FZD8)

See below for Detailed Description

More details

CAD$1,564.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Gallus gallus (Chicken)

Uniprot NO.:Q9IA03

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AGAAELQPELAVAEHVRYESTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWG NEAIAGYAQYFHLAAWLLPSVKSIAVLALSSVDGDPVAGICYVGNQSLENLRGFVLAPLV VYLFTGSLFLLAGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFTVLYTVPATIVIACYI YEQHNREAWEQAQNCSCPGDPHRPKPDYAVFMLKYFM

Protein Names:Recommended name: Frizzled-8 Short name= Fz-8 Short name= cFz-8

Gene Names:Name:FZD8 Synonyms:FZ8

Expression Region:1-217

Sequence Info:full length protein

30 other products in the same category: