View larger

Recombinant Ralstonia solanacearum Hypersensitivity response secretion protein hrcR(hrcR)

CSB-CF706575RAR

Recombinant Ralstonia solanacearum Hypersensitivity response secretion protein hrcR(hrcR)

See below for Detailed Description

More details

CAD$1,564.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Ralstonia solanacearum (strain GMI1000) (Pseudomonas solanacearum)

Uniprot NO.:Q52488

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MQNVEFASLIVMAVAIALLPFAAMVVTSYTKIVVVLGLLRNALGVQQVPPNMVLNGIAMI VSCFVMAPVGMEAMQRAHVQINAQGGTNITQVMPLLDAARDPFREFLNKHTNAREKAFFM RSAQQLWPPAKAAQLKDDDLIVLAPAFTLTELTSAFRIGFLLYLAFIVIDLVIANLLMAL GLSQVTPSNVAIPFKLLLFVVMDGWSVLIHGLVNTYR

Protein Names:Recommended name: Hypersensitivity response secretion protein hrcR

Gene Names:Name:hrcR Synonyms:hrpT Ordered Locus Names:RSp0860 ORF Names:RS01631

Expression Region:1-217

Sequence Info:full length protein

30 other products in the same category: