View larger

Recombinant Bacillus halodurans Protease prsW(prsW)

CSB-CF873057BQS

Recombinant Bacillus halodurans Protease prsW(prsW)

See below for Detailed Description

More details

CAD$1,562.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

Uniprot NO.:Q9KCE6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFSLLTAAIAPAMALLCFFYLKNEYGSQTLGFVVRTFLIGALLMFPVMVLQHAFLAEGFF ANPLLKAFILYGFFEEFFKWFMLYFFAYKHVEFNRRYDGIIFGVSLSLGFASMENGLYLI ANGVETALGRALLPVSSHAIYGVIMGYYLGRAKMEEKHRKKWLVLSLFLPVLLHSLYDAI LLLWSKHFLFVMVPFMLVLWWVAIQKVKLANQLDR

Protein Names:Recommended name: Protease prsW EC= 3.4.-.- Alternative name(s): Protease responsible for activating sigma-W

Gene Names:Name:prsW Ordered Locus Names:BH1625

Expression Region:1-215

Sequence Info:full length protein

30 other products in the same category: