View larger

Recombinant Oryza sativa subsp. japonica CASP-like protein Os01g0363300(Os01g0363300, LOC_Os01g26120)

CSB-CF860573OFG

Recombinant Oryza sativa subsp. japonica CASP-like protein Os01g0363300(Os01g0363300, LOC_Os01g26120)

See below for Detailed Description

More details

CAD$1,562.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q9ARX2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MESSRGKPGLNGSGGGAAAFDYSSRRGYYTGAGAALPPLAAGSRAPPVDPCCVVLRVFVL LGTLASAVVMAADRQSTTVQIAAGEELAPPLRVPVTAKWTYSSAFVYFVVANAMVFAFSA AALAAVRRRSAVVPVMVGDLVAMALLFSAVGAAAQFGLLGERGNAHVRWAKVCDVYGPFC ERAMAAVVVALIAAFADLVLLMLTILTIHKASSYY

Protein Names:Recommended name: CASP-like protein Os01g0363300

Gene Names:Ordered Locus Names:Os01g0363300, LOC_Os01g26120 ORF Names:OsJ_01759, P0460H02.47, P0503E05.9

Expression Region:1-215

Sequence Info:full length protein

30 other products in the same category: