View larger

Recombinant Pyrophosphate-energized proton pump 2(hppA2)

CSB-CF849999RCT

Recombinant Pyrophosphate-energized proton pump 2(hppA2)

See below for Detailed Description

More details

CAD$1,562.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rhizobium leguminosarum bv. trifolii

Uniprot NO.:Q93AS1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AAIFFAGTPILESAMVYPLAICGACILTSIAGTFFVKLGTNNSIMGALYKGLIATGVFSV AGLAVATYATVGWGTIGTVAGMEITGTNLFFCGLVGLVVTALIVVITEYYTGTNKRPVNS IAQASVTGHGTNVIQGLAVSLESTALPAIVIVGGIIGTYQLGGLFGTGIAVTAMLGLAGM IVALDAFGPVTDNAGGIAEMAGLDPDVRKRPTRWM

Protein Names:Recommended name: Pyrophosphate-energized proton pump 2 EC= 3.6.1.1 Alternative name(s): Membrane-bound proton-translocating pyrophosphatase 2 Pyrophosphate-energized inorganic pyrophosphatase 2 Short name= H(+)-PPase 2

Gene Names:Name:hppA2

Expression Region:1-215

Sequence Info:full length protein

30 other products in the same category: