View larger

Recombinant Oceanobacillus iheyensis Protease prsW(prsW)

CSB-CF817775OAB

Recombinant Oceanobacillus iheyensis Protease prsW(prsW)

See below for Detailed Description

More details

CAD$1,562.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831)

Uniprot NO.:Q8EQA1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLSILSAGIAPALALLSYIYLKDKITEPIWLIIRMFILGALLVLPIMFIQYAISSEFNYD SIFIEAFFQIALLEEFFKWFVFMFVIYQHEEFDNHYDGIVYASSLSLGFASIENILYLIT NGIEYAFLRAVFPVSSHALFGIIMGYYLGKAKTHTNYKKKNLTLAFLLPFLLHGIYNFIL KGFSSFTLILTPFMVLLWIIALYRLKRANENTIIN

Protein Names:Recommended name: Protease prsW EC= 3.4.-.- Alternative name(s): Protease responsible for activating sigma-W

Gene Names:Name:prsW Ordered Locus Names:OB1807

Expression Region:1-215

Sequence Info:full length protein

30 other products in the same category: