View larger

Recombinant Sorghum bicolor CASP-like protein Sb05g025800 (Sb05g025800)

CSB-CF514717FJS

Recombinant Sorghum bicolor CASP-like protein Sb05g025800 (Sb05g025800)

See below for Detailed Description

More details

CAD$1,562.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Sorghum bicolor (Sorghum) (Sorghum vulgare)

Uniprot NO.:C5Y7C7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MHDEEKKEPKWVTAVSIAGRIAGMGLAVAAAVLMSTASQCTVYYAAPAASAYGGAARART VTYSDFPPFVFLVGAASIAAFLEAIAIFLVVWKKGKDKTTKVLMPLLGVAVPALLYSATG AAFAAVSDMSYCSANGKRVSICAGSAAAGGGVSGGTNFCSQVHIAVYLSLAAAVAVSVAE VVRGLGGSASGGGSDSDSSSSSESGGCDHGCHHKH

Protein Names:Recommended name: CASP-like protein Sb05g025800

Gene Names:Ordered Locus Names:Sb05g025800

Expression Region:1-215

Sequence Info:full length protein

30 other products in the same category: