View larger

Recombinant Campylobacter fetus subsp. fetus Putative protein-disulfide oxidoreductase (CFF8240_0434)

CSB-CF370028CWC

Recombinant Campylobacter fetus subsp. fetus Putative protein-disulfide oxidoreductase (CFF8240_0434)

See below for Detailed Description

More details

CAD$1,562.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Campylobacter fetus subsp. fetus (strain 82-40)

Uniprot NO.:A0RN51

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEFFKDLKSDPIGKVASLQDERAIWIIMVVAMSGLVIVAHSLFQNYVYMAPCEQCVYIRF SMLVMALGGVIAAINPKNIILKIIGYVLGFYGAIIGMMYCIKLNSIHHAVHSEDPFGVQG CSAEPSFPFGLPLDMWAPDWFKPTGDCGYDNPIVPDDVSLSWLQQWFVDFYSEGWYLIPS LKFMNMAQACFIAYAVAFILLFAMFICWILKLKRA

Protein Names:Recommended name: Putative protein-disulfide oxidoreductase

Gene Names:Ordered Locus Names:CFF8240_0434

Expression Region:1-215

Sequence Info:full length protein

30 other products in the same category: