View larger

Recombinant Bothriopsis bilineata Cytochrome b(MT-CYB)

CSB-CF015075BUQ

Recombinant Bothriopsis bilineata Cytochrome b(MT-CYB)

See below for Detailed Description

More details

CAD$1,561.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bothriopsis bilineata (Two-striped forest pitviper) (Bothriechis bilineatus)

Uniprot NO.:P92847

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SINYKNMPHQHLLTLLSLLPVGSNISTWWNFGSMLLACLMTQIITGFFLAIHYTANINLA FSSIIHLSRDVPCGWIMQNTHAISASLFFICIYIHIARGLYYGSYLYKEVWLSGTTLLII LMATAFFGYVLPWGQMSFWAATVITNLLTAIPYLGTTLTTWLWGGFAINDPTLTRFFALH FIFPFIIISMSSIHILLLHNEGSSNPLGTNSDIG

Protein Names:Recommended name: Cytochrome b Alternative name(s): Complex III subunit 3 Complex III subunit III Cytochrome b-c1 complex subunit 3 Ubiquinol-cytochrome-c reductase complex cytochrome b subunit

Gene Names:Name:MT-CYB Synonyms:COB, CYTB, MTCYB

Expression Region:1-214

Sequence Info:full length protein

30 other products in the same category: