View larger

Recombinant Uncharacterized membrane protein ML0467(ML0467)

CSB-CF676575MVN

Recombinant Uncharacterized membrane protein ML0467(ML0467)

See below for Detailed Description

More details

CAD$1,561.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mycobacterium leprae

Uniprot NO.:Q49642

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDVDALLQSIPPLAVYLLVSGVVGVESLGIPLPGEVVLVSAALLSSRHDLAVSSIGVGVV AVIGAAVGDSIGYAIGRRFGMPLFDHLGRRFPKHFGPGHVALVERLFNRWGVRAVFFGRF IALLRILAGPLAGALKMHYPRFLAANVSGAICWAGGTTALVYFAGMAAERWMERFSWIAL IITVVVGIIAAILLRERTSRIIAELEMEYKNRRH

Protein Names:Recommended name: Uncharacterized membrane protein ML0467

Gene Names:Ordered Locus Names:ML0467 ORF Names:B1177_C2_172/B1177_C1_140, MLCL581.27

Expression Region:1-214

Sequence Info:full length protein

30 other products in the same category: