View larger

Recombinant Anser caerulescens NADH-ubiquinone oxidoreductase chain 5(MT-ND5)

CSB-CF655226AKY

Recombinant Anser caerulescens NADH-ubiquinone oxidoreductase chain 5(MT-ND5)

See below for Detailed Description

More details

CAD$1,561.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Anser caerulescens (Snow goose) (Chen caerulescens)

Uniprot NO.:Q31651

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:GSVDLQPSLNTSYLNTWALLLTLMATAFTATYSIRMTILVQAGQTRIPPMVSMNENNPLI TAPLTRLALGSITAGMIITSFITPTKTPPMTMPLITKTAAILMTILGIILALELSNMTHT LTYPKPNPLMNFSSALGYFNPLVHRFFSKNLLEKGQNIALHLIDLSWLKKMGPEGLAELQ VAASKAATSMHTGLIKAYLGSFALSILVMILMTH

Protein Names:Recommended name: NADH-ubiquinone oxidoreductase chain 5 EC= 1.6.5.3 Alternative name(s): NADH dehydrogenase subunit 5

Gene Names:Name:MT-ND5 Synonyms:MTND5, NADH5, ND5

Expression Region:1-214

Sequence Info:full length protein

30 other products in the same category: