View larger

Recombinant Citrus leprosis virus C Uncharacterized protein p24(p24)

CSB-CF629721CBAQ

Recombinant Citrus leprosis virus C Uncharacterized protein p24(p24)

See below for Detailed Description

More details

CAD$1,561.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Citrus leprosis virus C (isolate Citrus sinesis/Brazil/Cordeiropolis/2003) (CiLV-C)

Uniprot NO.:Q1KZ54

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDAQLLQANKRLLRRAANVRQRYKMLATESFVADIKQILLRFIQKPNVIIMYISVLVLFA AHIDSNTHDILDDLAAQFPNNTFIEWAKSNFFRICGALVFIPVIIDTEEKHRNYLALVIF VFLMGFPQRSIMEYFIYSISFHVYAKAKHPVTRIFIIGAAVFSCVMFGIFTNEQLRKLYA ELPKVPTHPVAVNRVEKVANRASRVSTEGTVNFG

Protein Names:Recommended name: Uncharacterized protein p24

Gene Names:Name:p24 Synonyms:ORF4

Expression Region:1-214

Sequence Info:full length protein

30 other products in the same category: