View larger

Recombinant Clostridium perfringens Putative AgrB-like protein(CPR_1532)

CSB-CF612824CAAP

Recombinant Clostridium perfringens Putative AgrB-like protein(CPR_1532)

See below for Detailed Description

More details

CAD$1,561.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Clostridium perfringens (strain SM101 / Type A)

Uniprot NO.:Q0SSQ8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIENLSKLISEKVSSELNYDNERKEIIQYGTYALIQTLISIISVFIIGLLFNIALEALIF LFTASILRKYSGGAHSESSNVCTLLGIIISICIGFLVKSSFFTKMNFEIIVFIGIVIFVF GYFIVFKFAPVDTKNKPIKTEKKKKRMKKGSLKILTIYLFIEILSIILYYNLGWSLVKSV MLSIILGVAWQCITLTYIGNILLKTIDSFTNKLL

Protein Names:Recommended name: Putative AgrB-like protein EC= 3.4.-.-

Gene Names:Ordered Locus Names:CPR_1532

Expression Region:1-214

Sequence Info:full length protein

30 other products in the same category: