View larger

Recombinant Ricinus communis CASP-like protein RCOM_1491260 (RCOM_1491260)

CSB-CF497502RMM

Recombinant Ricinus communis CASP-like protein RCOM_1491260 (RCOM_1491260)

See below for Detailed Description

More details

CAD$1,561.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Ricinus communis (Castor bean)

Uniprot NO.:B9RQG7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTNGQKIEVAVQLPESKVAATENNETMSGPLVVGGGVAKPFGRKADVMHVILRLLCTITS VTAVSFMVTAHQSSTVSIYGFMLPVRSKWSFSHSFEYLVGVSAAVAAHSLLQLLISMSRL LRKSPVIPSRSHAWLIFAGDQVFAYAMISAGAAASGVTNLNRTGIQHTALPNFCKPLNYF CNHVAVSIAFAFISCLLLAALAVQEVIWLSKSKY

Protein Names:Recommended name: CASP-like protein RCOM_1491260

Gene Names:ORF Names:RCOM_1491260

Expression Region:1-214

Sequence Info:full length protein

30 other products in the same category: