View larger

Recombinant Human CDP-diacylglycerol--inositol 3-phosphatidyltransferase(CDIPT)

CSB-CF005059HU

Recombinant Human CDP-diacylglycerol--inositol 3-phosphatidyltransferase(CDIPT)

See below for Detailed Description

More details

CAD$1,560.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:O14735

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPDENIFLFVPNLIGYARIVFAIISFYFMPCCPLTASSFYLLSGLLDAFDGHAARALNQG TRFGAMLDMLTDRCSTMCLLVNLALLYPGATLFFQISMSLDVASHWLHLHSSVVRGSESH KMIDLSGNPVLRIYYTSRPALFTLCAGNELFYCLLYLFHFSEGPLVGSVGLFRMGLWVTA PIALLKSLISVIHLITAARNMAALDAADRAKKK

Protein Names:Recommended name: CDP-diacylglycerol--inositol 3-phosphatidyltransferase EC= 2.7.8.11 Alternative name(s): Phosphatidylinositol synthase Short name= PI synthase Short name= PtdIns synthase

Gene Names:Name:CDIPT Synonyms:PIS, PIS1

Expression Region:1-213

Sequence Info:Full length protein

30 other products in the same category: