View larger

Recombinant Alcaligenes xylosoxydans xylosoxydans Nickel-cobalt-cadmium resistance protein nccN(nccN)

CSB-CF671532AGR

Recombinant Alcaligenes xylosoxydans xylosoxydans Nickel-cobalt-cadmium resistance protein nccN(nccN)

See below for Detailed Description

More details

CAD$1,560.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Alcaligenes xylosoxydans xylosoxydans (Achromobacter xylosoxidans)

Uniprot NO.:Q44587

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNISLRPAIAAPSPLDSFLTRHRIGIWRVVVSVVLIALITGHSQWDDTWISAALLTVGML GVTMATVGRLWCALYISGRKSTELVTTGPYSMCRHPLYVCNFVGIVGLGAMTESITLAAI LALAFALMYPAVIRSEDHLLSRNFPEFDDYARRTPAFFPRLSLFRSESTYLVHVGSFQRN LADSVWFLGMTIVVNAVELARHAKWLPTFVLLP

Protein Names:Recommended name: Nickel-cobalt-cadmium resistance protein nccN

Gene Names:Name:nccN

Expression Region:1-213

Sequence Info:full length protein

30 other products in the same category: