View larger

Recombinant Shewanella oneidensis Putative protein-disulfide oxidoreductase(SO_3870)

CSB-CF812334SGA

Recombinant Shewanella oneidensis Putative protein-disulfide oxidoreductase(SO_3870)

See below for Detailed Description

More details

CAD$1,559.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Shewanella oneidensis (strain MR-1)

Uniprot NO.:Q8EAM8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSINEVFRSFKAQPVNQLAKIQAERPIWFVMVGAAIFLILSAIFYFQLFLAMAPCEKCVY IRFSQSCIVIAGLIILINPRNNILKTLGLLLAWYAMIQGWIWSFELMKIHDAAHMVVDES MDFFAAAGDAAGSACSTEPRFPLGLPLDKWLPFEFAPTGGCGEDDWALFGLNMAHYCMIA YATFMVCLAPLTLGWFASFMTDRRNTIVYQTR

Protein Names:Recommended name: Putative protein-disulfide oxidoreductase

Gene Names:Ordered Locus Names:SO_3870

Expression Region:1-212

Sequence Info:full length protein

30 other products in the same category: