View larger

Recombinant Leptothrix cholodnii Probable intracellular septation protein A (Lcho_1840)

CSB-CF454003LOT

Recombinant Leptothrix cholodnii Probable intracellular septation protein A (Lcho_1840)

See below for Detailed Description

More details

CAD$1,559.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) (Leptothrix discophora (strain SP-6))

Uniprot NO.:B1XZY0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKLFLDFLPIILFFLTFKVAEGRAEEAAAFATEHLGALVSGGVVGAAEAPVLLATVVVIL ATLAQVLYLKLRGQKVDTMLWVSLGLVTVMGGATIWFHSETFIKWKPSVLYWVMSAAFLL APIVAGKDLLRAMLGGQIELPAFAWKKLNLAWAAFFAGMGVLNIWVAYNFSTSTWATFKA FGGMGLMFVFMLAQGLYMHRHMKVDGIKADES

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:Lcho_1840

Expression Region:1-212

Sequence Info:full length protein

30 other products in the same category: