View larger

Recombinant Human Claudin-1(CLDN1)

CSB-CF005490HU

Recombinant Human Claudin-1(CLDN1)

See below for Detailed Description

More details

CAD$1,558.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:O95832

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MANAGLQLLGFILAFLGWIGAIVSTALPQWRIYSYAGDNIVTAQAMYEGLWMSCVSQSTG QIQCKVFDSLLNLSSTLQATRALMVVGILLGVIAIFVATVGMKCMKCLEDDEVQKMRMAV IGGAIFLLAGLAILVATAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGA LLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV

Protein Names:Recommended name: Claudin-1 Alternative name(s): Senescence-associated epithelial membrane protein

Gene Names:Name:CLDN1 Synonyms:CLD1, SEMP1 ORF Names:UNQ481/PRO944

Expression Region:1-211

Sequence Info:Full length protein

30 other products in the same category: