View larger

Recombinant Bovine Claudin-7(CLDN7)

CSB-CF658944BO

Recombinant Bovine Claudin-7(CLDN7)

See below for Detailed Description

More details

CAD$1,558.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:Q3B7N4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTG MMSCKMYDSVLSLPAALQATRALMVVSLVLGFLATFVATMGMKCTNCGGDDKVKKARIAM TGGIIFILAGLAALIACSWYGHQIVSDFYNPLVPMNVKYEFGPAIFIGWAGSALVLLGGA LLSCSCPGSESKAGYRAPRSYPKPNSAKEYV

Protein Names:Recommended name: Claudin-7

Gene Names:Name:CLDN7

Expression Region:1-211

Sequence Info:full length protein

30 other products in the same category: