View larger

Recombinant Shigella boydii serotype 18 Sulfoxide reductase heme-binding subunit YedZ(yedZ)

CSB-CF464573SYZ

Recombinant Shigella boydii serotype 18 Sulfoxide reductase heme-binding subunit YedZ(yedZ)

See below for Detailed Description

More details

CAD$1,558.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)

Uniprot NO.:B2TWL3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRLTAKQVTWLKVSLHLAGLLPFLWLVWAINHGGLGADPVKDIQHFTGRTALKFLLATLL ITPLARYAKQPLLIRTRRLLGLWCFAWATLHLTSYALLELGVNNLALLGKELITRPYLTL GIISWVILLALAFTSTQAMQRKLGKHWQQLHNFVYLVAILAPIHYLWSVKIISPQPLIYA GLAVLLLALRYKKLRSLFNRLRKQVHNKLSV

Protein Names:Recommended name: Sulfoxide reductase heme-binding subunit YedZ Alternative name(s): Flavocytochrome YedZ

Gene Names:Name:yedZ Ordered Locus Names:SbBS512_E0911

Expression Region:1-211

Sequence Info:full length protein

30 other products in the same category: