View larger

Recombinant Haemophilus influenzae Probable amino-acid ABC transporter permease protein HI_0179 (HI_1079)

CSB-CF338034HTA

Recombinant Haemophilus influenzae Probable amino-acid ABC transporter permease protein HI_0179 (HI_1079)

See below for Detailed Description

More details

CAD$1,557.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

Uniprot NO.:P45023

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLEAAILYTLPLAVISFFCGLLIAVIVAVIRTLPSPNLPLKLLQALCRVYISIIRGTPML VQIFIIFYGLPEVGITLEPFPTAIIAFSINIGAYAAETVRASIIAIPKGQWEASYAIGMN YRQAFIRTIMPQALRISVPSLSNTFISTVKDTSLASLVLVTELFRVAQNITAANYEFILI YSEAALIYWIFCFVLSFLQDRLEIRLSRHL

Protein Names:Recommended name: Probable amino-acid ABC transporter permease protein HI_0179

Gene Names:Ordered Locus Names:HI_1079

Expression Region:1-210

Sequence Info:full length protein

30 other products in the same category: