View larger

Recombinant Candida glabrata Protein SYM1(SYM1)

CSB-CF749878CZI

Recombinant Candida glabrata Protein SYM1(SYM1)

See below for Detailed Description

More details

CAD$1,557.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)

Uniprot NO.:Q6FXJ3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIRLFQLYEHQLKVRPKLTNSIMTGALFGIGDVSAQLLFPSGPDTLPPSAQTNDVKRGKY DIPRTVRAVVYGSMIFSFIGDRWYRFLTKVKFSNKPAKHWSNMVLRVCVDQLGFAPLGLP FYFGCMSLLEGHGLGAAREKIKLQWWDTLKTNWCVWPLFQMVNFSLVPLQHRLLAANVVA IFWNTFLSYTNSQIPVGGHKLTVQYPPTVQ

Protein Names:Recommended name: Protein SYM1

Gene Names:Name:SYM1 Ordered Locus Names:CAGL0B03465g

Expression Region:1-210

Sequence Info:full length protein

30 other products in the same category: