View larger

Recombinant Human Tetraspanin-31(TSPAN31)

CSB-CF622522HU

Recombinant Human Tetraspanin-31(TSPAN31)

See below for Detailed Description

More details

CAD$1,557.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q12999

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVCGGFACSKNALCALNVVYMLVSLLLIGVAAWGKGLGLVSSIHIIGGVIAVGVFLLLIA VAGLVGAVNHHQVLLFFYMIILGLVFIFQFVISCSCLAINRSKQTDVINASWWVMSNKTR DELERSFDCCGLFNLTTLYQQDYDFCTAICKSQSPTCQMCGEKFLKHSDEALKILGGVGL FFSFTEILGVWLAMRFRNQKDPRANPSAFL

Protein Names:Recommended name: Tetraspanin-31 Short name= Tspan-31 Alternative name(s): Sarcoma-amplified sequence

Gene Names:Name:TSPAN31 Synonyms:SAS

Expression Region:1-210

Sequence Info:full length protein

30 other products in the same category: