View larger

Recombinant Uncharacterized protein B0416.3(B0416.3)

CSB-CF612081CXY

Recombinant Uncharacterized protein B0416.3(B0416.3)

See below for Detailed Description

More details

CAD$1,557.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Caenorhabditis elegans

Uniprot NO.:Q11071

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNEDNHESSSSGCDNQIEFLVSEAEQRRRRVNHLDTEVHGLGYDPFSYCGRRVHVLLLTK LISVLTIPFYVAIIIFISFFGNATSVMFSVIILGSVLISTCYGAFRGAKMCLIPFVIIQL VFLIYDLILITILLLAVVFPKMFLSALLRLPLEDIPFGTDQVLLGCSLLLALLLAPLVWT THVVYIDFLFISQANQKVSQDDVSPNRMMF

Protein Names:Recommended name: Uncharacterized protein B0416.3

Gene Names:ORF Names:B0416.3

Expression Region:1-210

Sequence Info:full length protein

30 other products in the same category: