View larger

Recombinant Photosystem II 22 kDa protein, chloroplastic(PSBS)

CSB-CF861868SKAR

Recombinant Photosystem II 22 kDa protein, chloroplastic(PSBS)

See below for Detailed Description

More details

CAD$1,556.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Solanum sogarandinum

Uniprot NO.:Q9FPP4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:APPKKVAPPKEKQKVEDGIFGTSGGIGFTKQNELFVGRVAMIGFAASLLGEAITGKGILA QLNLETGIPIYEAEPLLLFFILFNLLGAIGALGDRGRFIDDPAPATGLEKAVIPPGKSFK SALGLSEGGPLFGFTKANELFVGRLAQLGIAFSIIGEIITGKGALAQLNFETGVPINEIE PLLLFNIAFFFFAAINPGTGKFITDEEED

Protein Names:Recommended name: Photosystem II 22 kDa protein, chloroplastic Alternative name(s): CP22

Gene Names:Name:PSBS

Expression Region:68-276

Sequence Info:full length protein

30 other products in the same category: