View larger

Recombinant Clostridium acetobutylicum Putative AgrB-like protein(CA_C0078)

CSB-CF847382DUB

Recombinant Clostridium acetobutylicum Putative AgrB-like protein(CA_C0078)

See below for Detailed Description

More details

CAD$1,556.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787)

Uniprot NO.:Q97MW3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKGKSSVMEKLAEVVSLKLNKHLKMEGIELIKLKLGVEIIFINISKLAILFLVSYYFGLI KETIIMLAAFGFLRSNAFGLHAKNSIVCTVMSLLMFVLGAYLSKYLLFNNYMVLASFIIV NLLLFRYAPGDTEAHPLVGAKLRDKLKKQAVLMGMLLMAITLIIPDELIKTCISLSSYFE IISILPITYKVLGRRYKNYYEFERTIKQS

Protein Names:Recommended name: Putative AgrB-like protein EC= 3.4.-.-

Gene Names:Ordered Locus Names:CA_C0078

Expression Region:1-209

Sequence Info:full length protein

30 other products in the same category: