View larger

Recombinant Thiomicrospira crunogena Glycerol-3-phosphate acyltransferase(plsY)

CSB-CF653876TAAD

Recombinant Thiomicrospira crunogena Glycerol-3-phosphate acyltransferase(plsY)

See below for Detailed Description

More details

CAD$1,556.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Thiomicrospira crunogena (strain XCL-2)

Uniprot NO.:Q31EM0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIGLSEIELAGIAGAYFLGSLSSAIIVCRLMGLGDPRQEGSGNPGATNVKRLYGSKPAAI TLLGDMLKGVVPVALANMAGWSPLAIILVGFASFIGHLYPIFFGFRGGKGVATMLGVMFG LSLPIGAAVAGTWLFVAKVLKISSLSALIATALAPLYIYLLADGNMAWVSVTAIMTLILF WRHRSNIERLLKGEEDLIKKQPGASDPKE

Protein Names:Recommended name: Glycerol-3-phosphate acyltransferase Alternative name(s): Acyl-PO4 G3P acyltransferase Acyl-phosphate--glycerol-3-phosphate acyltransferase G3P acyltransferase Short name= GPAT EC= 2.3.1.n3 Lysophosphati

Gene Names:Name:plsY Ordered Locus Names:Tcr_1811

Expression Region:1-209

Sequence Info:full length protein

30 other products in the same category: