View larger

Recombinant Chicken Transmembrane protein 17(TMEM17)

CSB-CF023750CH

Recombinant Chicken Transmembrane protein 17(TMEM17)

See below for Detailed Description

More details

CAD$1,555.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Gallus gallus (Chicken)

Uniprot NO.:E1BY51

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSLPEPLRRRLGSFSRTVFTDSRRAGPQYPSERADNEILSSLPLQMSLYFNVYFFPFWWL STVFMLQLKYPVLSDYYKFILVTVMILTSLIEVIRLYLGYMGNLQEKVPELAGFWLLTLL LQLPVILFLLFNEGLNIQPLERSVNIIFALFLVFQVIAAFVTLKRMVNKLATHFHLNEFD RLEEHPVRHLYGPSKEENVLPMASMGPC

Protein Names:Recommended name: Transmembrane protein 17

Gene Names:Name:TMEM17

Expression Region:1-208

Sequence Info:full length protein

30 other products in the same category: