View larger

Recombinant Human Putative vomeronasal receptor-like protein 4(VN1R17P)

CSB-CF840574HU

Recombinant Human Putative vomeronasal receptor-like protein 4(VN1R17P)

See below for Detailed Description

More details

CAD$1,555.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q8TDU5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEMTKLFSYIVIKNVYYPQVSFGISANTFLLLFHIFTFAYTHRLKPIDMTISHLPLIHIL LLFTQAILVSSDLFESWNIQNNDLKCKIITFLNRVMRGVSICTTCLLSVLQAITISPSTS FLEKFKHISANHTLGFILFSWVLNMFITNNLLLFIVPTPNRIGASLLFVTEHCYVLPMSY THRSLFFILMVLRDVIFIGLMVLSSGYG

Protein Names:Recommended name: Putative vomeronasal receptor-like protein 4 Alternative name(s): G-protein coupled receptor GPCR23 Short name= hGPCR23

Gene Names:Name:VN1R17P Synonyms:VNRL4

Expression Region:1-208

Sequence Info:full length protein

30 other products in the same category: