View larger

Recombinant Arabidopsis thaliana CASP-like protein At4g11655(At4g11655)

CSB-CF668195DOA

Recombinant Arabidopsis thaliana CASP-like protein At4g11655(At4g11655)

See below for Detailed Description

More details

CAD$1,555.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q3EA54

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKELKDHVVVITYGPSSEASVTASPVSQQTPSLFAYSVTPSASRFSSRRASVHVIGLVLR FITMVLCFVSALSLAVNVQRPSKRHLTQNSSSFASYPELLYCFGVAVIGFVYTSLQTFKG VCDITHRGVLISEPLSDYISFIFDQVICYLLVSSSSVAIAWIQHINEDAIKTLRNNSIVS VSMSFSAFLVLTLSGLLSGYKLCKRFMW

Protein Names:Recommended name: CASP-like protein At4g11655

Gene Names:Ordered Locus Names:At4g11655 ORF Names:T5C23.2

Expression Region:1-208

Sequence Info:full length protein

30 other products in the same category: