View larger

Recombinant Drosophila melanogaster Protein late bloomer(lbm)

CSB-CF630504DLU

Recombinant Drosophila melanogaster Protein late bloomer(lbm)

See below for Detailed Description

More details

CAD$1,555.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Drosophila melanogaster (Fruit fly)

Uniprot NO.:Q24188

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGCATTSVKIASIVLNAVLGFLAAGAIGWIAYNADTETEEFVIAAYIACSLILVFALLGI FAAIRESVVLTATSAVFLLILAILQIVSTCLFLHEFDVKSGRDMVEVAWQANNMDSLQQK HECCGQSSAQDYIHLSLLIPPSCYADLQQTPDHLYLDGCIEKVQSFYESDKLRFIIVSWV LVAFELICFALAVFLAISFKNKQRRMEF

Protein Names:Recommended name: Protein late bloomer

Gene Names:Name:lbm Synonyms:lbl ORF Names:CG2374

Expression Region:1-208

Sequence Info:full length protein

30 other products in the same category: