View larger

Recombinant Bacillus subtilis Cytochrome c oxidase subunit 3(ctaE)

CSB-CF015074BRJ

Recombinant Bacillus subtilis Cytochrome c oxidase subunit 3(ctaE)

See below for Detailed Description

More details

CAD$1,553.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bacillus subtilis (strain 168)

Uniprot NO.:P24012

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MQVQEKFTAETFPASPEKVTLEGKNKFLGFWLFLGGETVLFASLFATFLALRNSNAGDPP TTEMFDVTLVFIATMLLLTSSLTSVYAMYHMKNFSFGKMQLWLGITILLGAGFLGLEIYE FKHYTHEFGFTITSSALGSAFYTLVGTHGAHVAFGLMWISTLMIRNAKRGLNLYTAPKFY VASLYWHFIDVVWVFIFTVVYLMGMVG

Protein Names:Recommended name: Cytochrome c oxidase subunit 3 EC= 1.9.3.1 Alternative name(s): Caa-3605 subunit 3 Cytochrome aa3 subunit 3 Cytochrome c oxidase polypeptide III Oxidase aa(3) subunit 3

Gene Names:Name:ctaE Ordered Locus Names:BSU14910

Expression Region:1-207

Sequence Info:full length protein

30 other products in the same category: