View larger

Recombinant Rat Claudin-11(Cldn11)

CSB-CF859166RA

Recombinant Rat Claudin-11(Cldn11)

See below for Detailed Description

More details

CAD$1,553.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:Q99P82

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVATCLQVVGFVTSFVGWIGIIVTTSTNDWVVTCSYTIPTCRKMDELGSKGLWADCVMAT GLHHCKPLVDILILPGYAQACRALMIAASVLGLPGILLLLTVLPCIRMGHEPGVAKYRRA QLAGVLLILLALCAIVATIWFPVCAHREITIVSFGYSLYAGWIGAVMCLVGGCVIVCCSG DAQSFGENRFYYSSGSSSPTHAKSAHV

Protein Names:Recommended name: Claudin-11

Gene Names:Name:Cldn11

Expression Region:1-207

Sequence Info:full length protein

30 other products in the same category: