View larger

Recombinant Gossypium hirsutum CASP-like protein F16(F16)

CSB-CF823831GHB

Recombinant Gossypium hirsutum CASP-like protein F16(F16)

See below for Detailed Description

More details

CAD$1,553.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Gossypium hirsutum (Upland cotton) (Gossypium mexicanum)

Uniprot NO.:Q8W4Z5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEKSEKGNGVAPATRSPMALMGSSRNENQEVNTSMRTAETMLRLVPMALGVAALVVMLKN SQSNDFGSVSYSDLGAFRYLVHANGICAGYSLLSAIIAAVPSPSTMPRAWTFFLLDQILT YVILGAAAVSTEVLYLANKGDSAITWSAACGTFAGFCHKATIAVVITFVAVICYAVLSLV SSYRLFTKFDAPVNYPSKTIEATVFHG

Protein Names:Recommended name: CASP-like protein F16

Gene Names:Name:F16

Expression Region:1-207

Sequence Info:full length protein

30 other products in the same category: