View larger

Recombinant Macaca fascicularis Claudin-11(CLDN11)

CSB-CF680978MOV

Recombinant Macaca fascicularis Claudin-11(CLDN11)

See below for Detailed Description

More details

CAD$1,553.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Uniprot NO.:Q4R3L1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVATCLQVVGFVTSFVGWIGVIVTTSTNDWVVTCGYTIPTCRKLDELGSKGLWADCVMAT GLYHCKPLVDILILPGYVQACRALMIAASVLGLPAILLLLTVLPCIRMGHEPGVAKYRRA QLAGVLLILLALCAIVATIWFPVCAHRETTIVSFGYSLYAGWIGAVLCLVGGCVILCCAG DAQAFGENRFYYSSGSSSPTHAKSAHV

Protein Names:Recommended name: Claudin-11

Gene Names:Name:CLDN11 ORF Names:QtsA-16119

Expression Region:1-207

Sequence Info:full length protein

30 other products in the same category: