View larger

Recombinant Synechocystis sp. Uncharacterized membrane protein slr1627 (slr1627)

CSB-CF304193SSQ

Recombinant Synechocystis sp. Uncharacterized membrane protein slr1627 (slr1627)

See below for Detailed Description

More details

CAD$1,552.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Synechocystis sp. (strain PCC 6803 / Kazusa)

Uniprot NO.:P74343

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLTMGWSNILSLFGAMLILAALPSLSVLTVSSKSASGGFIHGLFAALGVVLGDIIFILIA LWGLAFLRGAMGDFFVILKYISGIYLSWLGINTIRAKVNNQSLAKVDVKSLSSSFSAGLL ITLADQKAVLFYLGFLPTFVDVNNIAYLDIAVIILTAILTVGGVKIFYAFLAHRSGLLIS RQNKRIMNYLAGALMISVGVFLLISS

Protein Names:Recommended name: Uncharacterized membrane protein slr1627

Gene Names:Ordered Locus Names:slr1627

Expression Region:1-206

Sequence Info:full length protein

30 other products in the same category: