View larger

Recombinant Sulfolobus acidocaldarius Undecaprenyl-diphosphatase(sepP)

CSB-CF301298FOZ

Recombinant Sulfolobus acidocaldarius Undecaprenyl-diphosphatase(sepP)

See below for Detailed Description

More details

CAD$1,552.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)

Uniprot NO.:P80143

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRKYYYWILLLLFLILSIYIKLIGGEQNIGFNVELFKLINYNQIATLNGLMVFLSKYGRE YVWIPVTALLLIFKRTRKIGITLVISFVIAIVLGEVSKYVMAQLRPFNFVNPTYLLEPKP TDYSYPSGHALIVSTGAVTLLLTSPKWMWILGIIEAVLVSYSRVYVGVHWPLDVIAGWLL GSWISFLSVQIESTGPIKKIEQMLKA

Protein Names:Recommended name: Undecaprenyl-diphosphatase EC= 3.6.1.27 Alternative name(s): Dolicholpyrophosphatase

Gene Names:Name:sepP Ordered Locus Names:Saci_1025

Expression Region:1-206

Sequence Info:full length protein

30 other products in the same category: