View larger

Recombinant Salmonella typhimurium Threonine efflux protein(rhtC)

CSB-CF888680SXB

Recombinant Salmonella typhimurium Threonine efflux protein(rhtC)

See below for Detailed Description

More details

CAD$1,552.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

Uniprot NO.:Q9L6N7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MMMLFFTVAMVHIVALMSPGPDFFFVSQTAVSRSRKEAMMGVLGITCGVMVWAGVALLGL HLIIEKMAWLHTIIMVGGGLYLCWMGYQMLRGALKKQDAAASSPHIELAQSGRSFLKGLL TNLSNPKAIIYFGSVFSLFVGDNVGAAARWGIFALITLETLAWFTVVASLFALPKMRRGY QRLAKWIDGFAGALFAGFGIHLIISR

Protein Names:Recommended name: Threonine efflux protein

Gene Names:Name:rhtC Ordered Locus Names:STM3959 ORF Names:STMD1.31

Expression Region:1-206

Sequence Info:full length protein

30 other products in the same category: