Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:Q9SHU7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:SVPGDNEVDKAKLAQVAKRLEKTSRYFKRLGSIGFWGQLVSTVVAAVILSFSIVVTGKPT SPATFYATASGIAAAFVSVFWSFGYIRLSERLRRTSIDPAKAPPRADVVKGLRSGIMVNI LGMGSALLGMQATVGFLVAKALTTSANPFYQGVSQGYSPVLALDVFLVQASANTLLSHFL GLVCSLELLRSVTVPNSESVVVPKVA
Protein Names:Recommended name: Protein TIC 21, chloroplastic Alternative name(s): Protein CHLOROPLAST IMPORT APPARATUS 5 Short name= AtCIA5 Protein PERMEASE IN CHLOROPLASTS 1 Short name= AtPIC1 Translocon at the inner envelope membrane of
Gene Names:Name:TIC21 Synonyms:CIA5, PIC1 Ordered Locus Names:At2g15290 ORF Names:F27O10.6
Expression Region:91-296
Sequence Info:full length protein