View larger

Recombinant Arabidopsis thaliana Casparian strip membrane protein 1(CASP1)

CSB-CF874426DOA

Recombinant Arabidopsis thaliana Casparian strip membrane protein 1(CASP1)

See below for Detailed Description

More details

CAD$1,552.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9SIH4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAKESTTIDVGEPSTVTKSSSHVVKDAKKKGFVAVASRGGAKRGLAIFDFLLRLAAIAVT IGAASVMYTAEETLPFFTQFLQFQAGYDDLPAFQYFVIAVAVVASYLVLSLPFSIVSIVR PHAVAPRLILLICDTLVVTLNTSAAAAAASITYLAHNGNQSTNWLPICQQFGDFCQNVST AVVADSIAILFFIVLIIISAIALKRH

Protein Names:Recommended name: Casparian strip membrane protein 1

Gene Names:Name:CASP1 Ordered Locus Names:At2g36100 ORF Names:F9C22.3

Expression Region:1-206

Sequence Info:full length protein

30 other products in the same category: