Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Rhizobium leguminosarum bv. viciae (strain 3841)
Uniprot NO.:Q1MIH8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLSNLMSWQITLPIALAAAIIGYLFGSIPFGLILTRAAGLGDVRSIGSGNIGATNVLRTG NRTLAAATLLLDALKASAAAWVVSYFLGEEAAIIAGFFAFIGHLFPVWIGFKGGKGVATY IGTLLGVAPIMVVLFAAVWLAVAFTTRYSSLSALVAMLVIPVALWILGNEKVAAVMAIMT LISYWKHKANISRLMGGTESKIGAKG
Protein Names:Recommended name: Glycerol-3-phosphate acyltransferase 1 Alternative name(s): Acyl-PO4 G3P acyltransferase 1 Acyl-phosphate--glycerol-3-phosphate acyltransferase 1 G3P acyltransferase 1 Short name= GPAT 1 EC= 2.3.1.n3 Lys
Gene Names:Name:plsY1 Ordered Locus Names:RL1737
Expression Region:1-206
Sequence Info:full length protein