View larger

Recombinant Zygosaccharomyces rouxii Autophagy-related protein 33(ATG33)

CSB-CF513591ZBL

Recombinant Zygosaccharomyces rouxii Autophagy-related protein 33(ATG33)

See below for Detailed Description

More details

CAD$1,552.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) (Candida mogii)

Uniprot NO.:C5DRF7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSVCLGVTKGIAVSSLGIYAGILTTGTICTYMVPVDVITKHLNSVVCRVGEVASALGLLS TGFFSLSYFGAPSHLRHPYLIYSALVAPASALYLWAISRCNHKCHAKSKIAEQGKTNGDN KTQSPPLGDSVVDLGADSKVPSGHPPVKEGAKCPMGNAVVTNEPSSTDYARPAGCQSKFA KHLAVVTGVAIIGFLQSVIGVYGEPA

Protein Names:Recommended name: Autophagy-related protein 33

Gene Names:Name:ATG33 Ordered Locus Names:ZYRO0B08096g

Expression Region:1-206

Sequence Info:full length protein

30 other products in the same category: