View larger

Recombinant Vitis vinifera CASP-like protein VIT_17s0000g00560 (VIT_17s0000g00560)

CSB-CF417838VFQ

Recombinant Vitis vinifera CASP-like protein VIT_17s0000g00560 (VIT_17s0000g00560)

See below for Detailed Description

More details

CAD$1,552.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Vitis vinifera (Grape)

Uniprot NO.:A7PHN8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MCFQFSILYTCYLAHFGVFPRKYLVMAGIEAKFQQNPPLGTHKLFLGAHICLRILTVTAT LTAAWMMITSKQTVEVYGIQVEAKYSYSSAFKFFSYANAIACGCSVLTLFPAFSLFYRGS TPMKFFFLFLHDLCMMSLVLAGCAAATAIGYVGRYGNNHAGWMAICDQFDEYCNRIRLSL MFSYLAFVFILMLTIMSANKSREIRV

Protein Names:Recommended name: CASP-like protein VIT_17s0000g00560

Gene Names:Ordered Locus Names:VIT_17s0000g00560 ORF Names:GSVIVT00018013001, GSVIVT01008618001, VIT_00008618001, Vv17s0000g00560

Expression Region:1-206

Sequence Info:full length protein

30 other products in the same category: