View larger

Recombinant Rickettsia typhi NADH-quinone oxidoreductase subunit J(nuoJ)

CSB-CF734689RNE

Recombinant Rickettsia typhi NADH-quinone oxidoreductase subunit J(nuoJ)

See below for Detailed Description

More details

CAD$1,551.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rickettsia typhi (strain ATCC VR-144 / Wilmington)

Uniprot NO.:Q68VV9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPIFFYLFTTLIIISSLCVVLSKNSVYSVLWLIFTFINAAGLMILLGAEFLAMLLIVIYV GAVAVLFLFVIMMLDINFNQAITKLRENLSLSIFITLIMFVDLVITVILSTKNINHSSNI SFAIANNISNTKAIGSVLYTDFMLPFQMAGLILFVAMISCITLTLKKRERVKYQDIRKQL SHNKGNVILMTKPILNKGVENIKYE

Protein Names:Recommended name: NADH-quinone oxidoreductase subunit J EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit J NDH-1 subunit J

Gene Names:Name:nuoJ Ordered Locus Names:RT0777

Expression Region:1-205

Sequence Info:full length protein

30 other products in the same category: