View larger

Recombinant Salmonella schwarzengrund Glycerol-3-phosphate acyltransferase(plsY)

CSB-CF468177SWV

Recombinant Salmonella schwarzengrund Glycerol-3-phosphate acyltransferase(plsY)

See below for Detailed Description

More details

CAD$1,551.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Salmonella schwarzengrund (strain CVM19633)

Uniprot NO.:B4TVU1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSAIAPGMILFAYLCGSISSAILVCRIAGLPDPRESGSGNPGATNVLRIGGKGAAVAVLI FDILKGMLPVWGAYALGVTPFWLGLIAIAACLGHIWPVFFGFKGGKGVATAFGAIAPIGW DLTGVMAGTWLLTVLLSGYSSLGAIVSALIAPFYVWWFKPQFTFPVSMLSCLILLRHHDN IQRLWRRQETKIWTKLKKKRQKDSE

Protein Names:Recommended name: Glycerol-3-phosphate acyltransferase Alternative name(s): G3P acyltransferase Short name= GPAT EC= 2.3.1.15 EC= 2.3.1.n5 Lysophosphatidic acid synthase Short name= LPA synthase

Gene Names:Name:plsY Synonyms:ygiH Ordered Locus Names:SeSA_A3397

Expression Region:1-205

Sequence Info:full length protein

30 other products in the same category: