View larger

Recombinant Protein CrcB homolog 3(crcB3)

CSB-CF774267SNN

Recombinant Protein CrcB homolog 3(crcB3)

See below for Detailed Description

More details

CAD$1,550.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Streptomyces avermitilis

Uniprot NO.:Q82LR8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRADESGPERESREPTHIPGAEPELGGEPTPRGEPGPGFEPGPGGEPAPSRAPFRSRLRK GVLAAVALGGVLGGSARYALGLTFPTPRGTFPVTTFAVNVSGAFLLALLLVYVLEIWPPT RYVRPFAAVGFLGSFTTFSTWMVDTDRLLGHGHYAVAAFNVFGSLFAGLAATGLGLAIGR MALARRVRLAARHGRARRYGWWVR

Protein Names:Recommended name: Protein CrcB homolog 3

Gene Names:Name:crcB3 Ordered Locus Names:SAV_1942

Expression Region:1-204

Sequence Info:full length protein

30 other products in the same category: