Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Bacillus subtilis subsp. spizizenii (strain ATCC 23059 / NRRL B-14472 / W23)
Uniprot NO.:E0TW65
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEHAEHGNSNAPMEYQSETGRLNILGFWIFLGAEIVLFSTLFATFFVLQNRTAGGVLPDE LFEVNLVMIMTFLLLISSFTCGIAVHEMRRGSLKGVVIWTIITLLLGAGFVGCEINEFVH YVHEGASLGTSAFWSGFFVLLGTHGTHVTIGIFWIIGILIQLKKRGLTPQTSSKIFISSL YWHFLDVVWIFIFTGVYLMGLGGL
Protein Names:Recommended name: Quinol oxidase subunit 3 EC= 1.10.3.- Alternative name(s): Oxidase aa(3)-600 subunit 3 Quinol oxidase aa3-600, subunit qoxC Quinol oxidase polypeptide III
Gene Names:Name:qoxC Ordered Locus Names:BSUW23_18865
Expression Region:1-204
Sequence Info:full length protein