View larger

Recombinant Listeria monocytogenes serotype 4b Putative AgrB-like protein (Lm4b_00057)

CSB-CF500477LPX

Recombinant Listeria monocytogenes serotype 4b Putative AgrB-like protein (Lm4b_00057)

See below for Detailed Description

More details

CAD$1,550.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Listeria monocytogenes serotype 4b (strain Clip81459)

Uniprot NO.:C1KV55

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSNFTAKVPLSERMADVLISKDRWKDDEEGYLKVKYGLEIILINVMKFALVYGIALVTGL LLQTVTVHLSYLWLRRYSFGLHATKTLNCTLISLMMFVLAPFVFQNIPSNNWIVLGTFGF ILLNMFLFAPADTESLPLIGEEHRKTLKRKAMIGTLILTGIALLIPFAEMKTLIMVGSLF QVISINPLTYKLLKRRYRNYEKYE

Protein Names:Recommended name: Putative AgrB-like protein EC= 3.4.-.-

Gene Names:Ordered Locus Names:Lm4b_00057

Expression Region:1-204

Sequence Info:full length protein

30 other products in the same category: